PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G52060.1
Common NameLOC102718971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1167aa    MW: 128104 Da    PI: 9.5094
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G52060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.63.7e-0776132157
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   +r+R  ++++ ++ +++lF+ + ++ ++e +e+++++g+t +qV+ +F  +R++ +k
  OB01G52060.1  76 KRPRDLLNPKAVKSMQSLFAVKDTIGKKETREISASCGVTVTQVREFFASQRTQVRK 132
                   799*************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.08673133IPR001356Homeobox domain
SuperFamilySSF466898.13E-675136IPR009057Homeodomain-like
SMARTSM003890.002975137IPR001356Homeobox domain
PfamPF000461.0E-476132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-576138IPR009057Homeodomain-like
CDDcd000865.00E-476132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1167 aa     Download sequence    Send to blast
MELVPLKPAA GALVESSGGG AAFGDSIPAT VAAQQEMLHA QVDQLRRLVV AQCRLTGVNP  60
LAQEMAAGAL CIKIGKRPRD LLNPKAVKSM QSLFAVKDTI GKKETREISA SCGVTVTQVR  120
EFFASQRTQV RKFVRLSREK ALRLQSSKAP DNLCYISSEQ APVDIEAHAQ VIEPLRTLEP  180
LDVQQSSLQH VMVPQISSQL PVVPPSYAIP VAPTDIMQVT VQLTDAKTNS DSIQKETKQD  240
GVSTGVESED KKFLESIFAL MRKENTFSGQ VKLMESILQI NNVTVLSWFL TMGGLAIVST  300
WLGEAVNEEQ TTVILVIFKL LLHLPLHKAL PAHMSTVLQT INRLRFYRTQ DISSKARNLL  360
SRLSKVLVRS QALKKSQKNL ICKQRINEIL RDESWKSEVG ITEGILALTE DASESRMPEA  420
KKTPLLLTAS ADESNKKSSL QTKSKERRKV LLVEHPNRKA VGKNVNPARS TSTNSSRPLS  480
ADDIQKAKMR AMFMQEKYGK VDTSKVTDKP HTMEIQKSSG LVDSNAPLVP RSPLTSIIKQ  540
SVDPSPSTSK QSILSPPDKP EVPVSSKLNI ATQENIIEKF DSKRVLWQIP PDVWIDPAWS  600
LGTGENSKEF EVQTQRNRRE KETFYTSLKD IPLNPKDPWD VEMDFDDSLT PEIPIDQPPD  660
ADAMETNSVG TAPPNIEVPV ADKQVGSTSL ISPVVAAGAN GAASEPDLEL LAVLLKNPQL  720
VFALTSNQGG TLPSEQTVAL LDMLKQTGLG LSELVNGLAN NSGVQKEPES GPETIPTSLP  780
SPTPPKDLAA RDGWRSEFPS QMRTSNLQRT HLPNRANVPP IASTVQQSFS NVVSSLPSQP  840
YASASALPAQ IQTNILALAQ SSISVNPSTQ HVAPMNNLLS RATVHQHTQS YALASDPIAV  900
AVHQQPAVNK LAHEVQNISH PSTTHSSVPE PHASHTSHTW QPSAATVATT GRNATPDRWS  960
TRTTSAFNVA PSNPVTYPKQ NAYSNHSTKG TTYNAYGSTP VTSHSLLPGQ GRDRNGYTHT  1020
TEYQTTARDA LRRNSRSPEL GAGAVYGGSQ SYVPEPSRQW SYGQQSYNPE PSRQWSSGQQ  1080
SYNSAEPSRQ WSSQQQQQQQ GYNNPAEPSR QWSSSQQQGY NPEPSRLWNS GRQSQNPEAP  1140
RQWNQHGKQE RYNPTDGRNS YDQRWRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666980.0AK066698.1 Oryza sativa Japonica Group cDNA clone:J013073H18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645287.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLJ3L7K00.0J3L7K0_ORYBR; Uncharacterized protein
STRINGOB01G52060.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-143HB-other family protein